Structure of PDB 6eec Chain F

Receptor sequence

>6eecF (length=319) Species: 1773 (Mycobacterium tuberculosis)

SEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLY
ATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAK
RYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRA
MADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPE
KVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQD
QLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIES
KTMSKLRHPSRSQVLRDYL

3D structure

• PDB: 6eec Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
• Chain: F
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	D226 V228 R229 L232 G236 L240 N299 R301 L302 S305 K334 D336 K339 Y341 K342 T345 Y346 W349 W350 Q353 R367 P369 H371 R470 V498 T499 E501 R502 Q505	D18 V20 R21 L24 G28 L32 N91 R93 L94 S97 K126 D128 K131 Y133 K134 T137 Y138 W141 W142 Q145 R159 P161 H163 R262 V290 T291 E293 R294 Q297
BS02	dna	F	R309 R313 W349 R352 R381 R384 R478 L489 R500 E501 R504	R101 R105 W141 R144 R173 R176 R270 L281 R292 E293 R296

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0009415 response to water
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:6eec, PDBe:6eec, PDBj:6eec
• PDBsum: 6eec
• PubMed: 30626968
• UniProt: P9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)