Structure of PDB 6e48 Chain F |
>6e48F (length=113) Species: 10090 (Mus musculus) [Search protein sequence] |
MEDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVE TDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDP MFKVTVNIGPVPT |
|
PDB | 6e48 Structural basis for murine norovirus engagement of bile acids and the CD300lf receptor. |
Chain | F |
Resolution | 1.801 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
F |
K94 G96 D98 |
K95 G97 D99 |
|
|
|