Structure of PDB 6ddg Chain F

Receptor sequence
>6ddgF (length=84) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
RDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASV
NIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSI
3D structure
PDB6ddg cryoEM-Guided Development of Antibiotics for Drug-Resistant Bacteria.
ChainF
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F T13 E14 K15 E22 K24 R32 N34 K35 T36 Q37 M40 N54 I55 M56 N57 Y58 K59 K61 K63 R64 M65 Y68 Q69 G70 N73 K74 R76 T10 E11 K12 E19 K21 R29 N31 K32 T33 Q34 M37 N51 I52 M53 N54 Y55 K56 K58 K60 R61 M62 Y65 Q66 G67 N70 K71 R73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ddg, PDBe:6ddg, PDBj:6ddg
PDBsum6ddg
PubMed30667174
UniProtQ2FW08|RL23_STAA8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]