Structure of PDB 6ddd Chain F

Receptor sequence
>6dddF (length=87) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
RDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASV
NIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
3D structure
PDB6ddd cryoEM-Guided Development of Antibiotics for Drug-Resistant Bacteria.
ChainF
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F T13 E14 K15 R32 N34 K35 T36 Q37 N54 I55 M56 Y58 K59 K61 K63 M65 Y68 Q69 G70 Y71 N73 I79 T10 E11 K12 R29 N31 K32 T33 Q34 N51 I52 M53 Y55 K56 K58 K60 M62 Y65 Q66 G67 Y68 N70 I76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ddd, PDBe:6ddd, PDBj:6ddd
PDBsum6ddd
PubMed30667174
UniProtQ2FW08|RL23_STAA8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]