Structure of PDB 6dcf Chain F

Receptor sequence

>6dcfF (length=297) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

DSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLPV
QQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEGN
LGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEV
INKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQ
TDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYL

3D structure

PDB

6dcf Rifamycin congeners kanglemycins are active against rifampicin-resistant bacteria via a distinct mechanism.

Chain

Resolution

3.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	L178 N237 R239 L240 R268 K272 D274 K277 Y279 K280 S282 T283 Y284 W287 W288 Q291 R295 R305 P307 H309 R408 V436 T437 R440 Q443	L15 N74 R76 L77 R105 K109 D111 K114 Y116 K117 S119 T120 Y121 W124 W125 Q128 R132 R142 P144 H146 R240 V268 T269 R272 Q275
BS02	dna	F	E312 R319 R416 T426 L427 R438 E439 R442	E149 R156 R248 T258 L259 R270 E271 R274

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6dcf, PDBe:6dcf, PDBj:6dcf
PDBsum	6dcf
PubMed	30297823
UniProt	A0QW02

[Back to BioLiP]