Structure of PDB 6d90 Chain F

Receptor sequence

>6d90F (length=225) Species: 9986 (Oryctolagus cuniculus)

NFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNT
LIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

3D structure

• PDB: 6d90 Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
• Chain: F
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	F24 A25 K28 K30 R31 L32 R33 R42 R46 K47 H57 Y60 R61 Y64 R65 R69 M70 R72 R75 G96 I97 N98 G99 P102 K103 K106 L110 Q115 K123 A127 N130 K147 R156 K164 R165 I166 T172 A175 R176 G179 I184 I190 N205 W208 K211 L212 S213 S214 P215 R216 G217 M219 K222	F2 A3 K6 K8 R9 L10 R11 R20 R24 K25 H35 Y38 R39 Y42 R43 R47 M48 R50 R53 G74 I75 N76 G77 P80 K81 K84 L88 Q93 K101 A105 N108 K125 R134 K142 R143 I144 T150 A153 R154 G157 I162 I168 N183 W186 K189 L190 S191 S192 P193 R194 G195 M197 K200
BS02	rna	F	R95 R133 E136 T223 T224 H225	R73 R111 E114 T201 T202 H203

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6d90, PDBe:6d90, PDBj:6d90
• PDBsum: 6d90
• PubMed: 29856316
• UniProt: G1SV32|RL7_RABIT Large ribosomal subunit protein uL30 (Gene Name=RPL7)