Structure of PDB 6cf2 Chain F

Receptor sequence

>6cf2F (length=57) Species: 11676 (Human immunodeficiency virus 1)

EDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERI
LSTYLGR

3D structure

• PDB: 6cf2 Structure of an RNA Aptamer that Can Inhibit HIV-1 by Blocking Rev-Cognate RNA (RRE) Binding and Rev-Rev Association.
• Chain: F
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	T34 R35 Q36 A37 R38 R39 N40 R41 R43 R44 R50	T25 R26 Q27 A28 R29 R30 N31 R32 R34 R35 R41

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0042025 host cell nucleus

External links

• PDB: RCSB:6cf2, PDBe:6cf2, PDBj:6cf2
• PDBsum: 6cf2
• PubMed: 30017564
• UniProt: P04616|REV_HV1B1 Protein Rev (Gene Name=rev)