Structure of PDB 6bzo Chain F

Receptor sequence

>6bzoF (length=326) Species: 1773 (Mycobacterium tuberculosis)

FVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAK
RIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLR
LVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWI
RQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAK
EMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAV
SFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRE
RIRQIESKTMSKLRHPSRSQVLRDYL

3D structure

• PDB: 6bzo Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
• Chain: F
• Resolution: 3.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	R301 L302 S305 K334 K339 Y341 K342 S344 T345 Y346 T348 W349 W350 Q353 R357 R367 P369 H371 E501 R502	R100 L101 S104 K133 K138 Y140 K141 S143 T144 Y145 T147 W148 W149 Q152 R156 R166 P168 H170 E300 R301
BS02	dna	F	R478 T488 L489 R500 E501 R504	R277 T287 L288 R299 E300 R303

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0009415 response to water
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:6bzo, PDBe:6bzo, PDBj:6bzo
• PDBsum: 6bzo
• PubMed: 29480804
• UniProt: P9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)