Structure of PDB 6bu8 Chain F |
>6bu8F (length=126) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS PMVKAKDERRERRDDFANETADDAEA |
|
PDB | 6bu8 Structural dynamics of protein S1 on the 70S ribosome visualized by ensemble cryo-EM. |
Chain | F |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
Q68 R79 R86 M90 |
Q68 R79 R86 M90 |
|
|
|
|