Structure of PDB 6bd1 Chain F

Receptor sequence

>6bd1F (length=230) Species: 9606 (Homo sapiens)

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKN
VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS

3D structure

• PDB: 6bd1 Mechanism of IRSp53 inhibition by 14-3-3.
• Chain: F
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	F	V46 K49 R56 R60 R127 Y128 L172 N173 Y179 E180 N224 W228	V46 K49 R56 R60 R127 Y128 L172 N173 Y179 E180 N224 W228
BS02	MG	F	D81 E84	D81 E84

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0044325 transmembrane transporter binding
• GO:0071889 14-3-3 protein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0007264 small GTPase-mediated signal transduction
• GO:0008104 protein localization
• GO:0021762 substantia nigra development
• GO:0034766 negative regulation of monoatomic ion transmembrane transport
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0045202 synapse
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6bd1, PDBe:6bd1, PDBj:6bd1
• PDBsum: 6bd1
• PubMed: 30696821
• UniProt: P27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)