Structure of PDB 6bcr Chain F

Receptor sequence
>6bcrF (length=230) Species: 9606 (Homo sapiens) [Search protein sequence]
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKN
VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS
3D structure
PDB6bcr Mechanism of IRSp53 inhibition by 14-3-3.
ChainF
Resolution1.986 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F S45 K49 N50 G53 R56 S57 R127 Y128 L172 N173 V176 E180 L220 N224 S45 K49 N50 G53 R56 S57 R127 Y128 L172 N173 V176 E180 L220 N224
BS02 MG F E84 E87 E84 E87
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0044325 transmembrane transporter binding
GO:0071889 14-3-3 protein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0008104 protein localization
GO:0021762 substantia nigra development
GO:0034766 negative regulation of monoatomic ion transmembrane transport
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bcr, PDBe:6bcr, PDBj:6bcr
PDBsum6bcr
PubMed30696821
UniProtP27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)

[Back to BioLiP]