Structure of PDB 6b5e Chain F

Receptor sequence

>6b5eF (length=284) Species: 83332 (Mycobacterium tuberculosis H37Rv)

MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQ
LITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGAD
SVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGGM
ALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQV
YLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEE
VAWRMGWIDDEQLVQRARALVKSGYGNYLLELLE

3D structure

• PDB: 6b5e The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.
• Chain: F
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.24: glucose-1-phosphate thymidylyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DAU	F	L6 G8 G9 Q24 Q80 P83 G85 L86 L106 D108 G143 E158 K159 V169 W220 D222	L6 G8 G9 Q24 Q80 P83 G85 L86 L106 D108 G143 E156 K157 V167 W218 D220
BS02	DAU	F	M43 Y112 G113 P114 G115 G117 T118 S119 V247 E252 V253 R256	M43 Y112 G113 P114 G115 G117 T118 S119 V245 E250 V251 R254
BS03	MG	F	D108 D222	D108 D220

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0008879 glucose-1-phosphate thymidylyltransferase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0009058 biosynthetic process
• GO:0019305 dTDP-rhamnose biosynthetic process
• GO:0045226 extracellular polysaccharide biosynthetic process
• GO:0046075 dTTP metabolic process

Cellular Component

• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:6b5e, PDBe:6b5e, PDBj:6b5e
• PDBsum: 6b5e
• PubMed: 29076563
• UniProt: P9WH13|RMLA_MYCTU Glucose-1-phosphate thymidylyltransferase (Gene Name=rmlA)