Structure of PDB 6az3 Chain F

Receptor sequence
>6az3F (length=137) Species: 5661 (Leishmania donovani) [Search protein sequence]
SRKSPEYTTLRKSCAPGVIAIILAGRFRGRRAVILKQLPHNGPLVVSGPM
KYNGVPIRRIDSRYVIATSTKVDISSVDTAPITPEVFVSDARAQLQKKID
AALIAAIKKDAQGKEKAGYLRSVFTVKPGDAPHRWNW
3D structure
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
ChainF
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F T28 N60 R82 Y83 T9 N41 R63 Y64
BS02 rna F A43 G44 R45 R47 M69 K70 G73 R77 R78 Y83 V146 S147 Q154 K166 R179 S180 V181 K185 P186 A24 G25 R26 R28 M50 K51 G54 R58 R59 Y64 V88 S89 Q96 K108 R121 S122 V123 K127 P128
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 22:31:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6az3', asym_id = 'F', title = 'Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6az3', asym_id='F', title='Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6az3', asym_id = 'F'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6az3', asym_id='F')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>