Structure of PDB 6awf Chain F

Receptor sequence

>6awfF (length=238) Species: 562 (Escherichia coli)

MKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLS
YRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDL
VVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCG
LCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVW
SCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATL

3D structure

• PDB: 6awf New crystal forms of the integral membrane Escherichia coli quinol:fumarate reductase suggest that ligands control domain movement.
• Chain: F
• Resolution: 3.35 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	F	C57 A60 C62 G63 C65 C77	C55 A58 C60 G61 C63 C75
BS02	F3S	F	C158 C204 F206 V207 G208 C210	C156 C202 F204 V205 G206 C208
BS03	SF4	F	C148 I149 C151 G152 C154 C214	C146 I147 C149 G150 C152 C212

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006113 fermentation
• GO:0009061 anaerobic respiration
• GO:0019645 anaerobic electron transport chain
• GO:0044780 bacterial-type flagellum assembly

Cellular Component

• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045283 fumarate reductase complex

External links

• PDB: RCSB:6awf, PDBe:6awf, PDBj:6awf
• PDBsum: 6awf
• PubMed: 29158068
• UniProt: P0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit (Gene Name=frdB)