Structure of PDB 6asb Chain F

Receptor sequence
>6asbF (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
RRTRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQSCLLRQCTAPVLPH
TAVCLLCFGLSLMECTICNEIVHPGCIPNCWECRC
3D structure
PDB6asb DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
ChainF
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R35 R36 R38 K69 Q70 S71 R75 R1 R2 R4 K35 Q36 S37 R41 PDBbind-CN: Kd=1.5uM
BS02 dna F R35 T37 R40 H54 R67 M68 K69 Q70 P83 H84 R1 T3 R6 H20 R33 M34 K35 Q36 P49 H50 PDBbind-CN: Kd=1.5uM
BS03 ZN F C39 C42 C45 C77 C5 C8 C11 C43
BS04 ZN F C53 C56 C72 C19 C22 C38
BS05 ZN F C88 H122 C125 C54 H73 C76
BS06 ZN F C114 C117 C65 C68
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:6asb, PDBe:6asb, PDBj:6asb
PDBsum6asb
PubMed29276034
UniProtQ6PCT2|FXL19_HUMAN F-box/LRR-repeat protein 19 (Gene Name=FBXL19)

[Back to BioLiP]