Structure of PDB 6ah3 Chain F

Receptor sequence
>6ah3F (length=157) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
INGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISK
NDNIKKSVNKLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKKG
YIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDLN
LHSFTKQ
3D structure
PDB6ah3 Structural insight into precursor tRNA processing by yeast ribonuclease P.
ChainF
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F S19 T20 K51 N52 D53 K56 V59 N60 K61 K90 S93 E96 I97 R122 R132 L133 K134 S18 T19 K50 N51 D52 K55 V58 N59 K60 K89 S92 E95 I96 R121 R131 L132 K133
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005697 telomerase holoenzyme complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ah3, PDBe:6ah3, PDBj:6ah3
PDBsum6ah3
PubMed30262633
UniProtP53218|POP6_YEAST Ribonucleases P/MRP protein subunit POP6 (Gene Name=POP6)

[Back to BioLiP]