Structure of PDB 5zzn Chain F

Receptor sequence
>5zznF (length=34) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
3D structure
PDB5zzn Thylakoid membrane lipid sulfoquinovosyl-diacylglycerol (SQDG) is required for full functioning of photosystem II inThermosynechococcus elongatus.
ChainF
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM F R19 W20 V23 H24 A27 I31 R8 W9 V12 H13 A16 I20
Gene Ontology
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zzn, PDBe:5zzn, PDBj:5zzn
PDBsum5zzn
PubMed30076221
UniProtQ8DIN9|PSBF_THEVB Cytochrome b559 subunit beta (Gene Name=psbF)

[Back to BioLiP]