Structure of PDB 5xmk Chain F

Receptor sequence

>5xmkF (length=319) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

LSSAILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSG
ILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLF
AMARENKPSIIFIDQVDALTGTRGEGESEASRRIKTELLVQMNGVGNDSQ
GVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCV
LTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSTEDD
ETRKLTPCSPGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVN
EDDLLKQEQFTRDFGQEGN

3D structure

PDB

5xmk Cryo-EM structures of the ATP-bound Vps4(E233Q) hexamer and its complex with Vta1 at near-atomic resolution

Chain

Resolution

4.18 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	F	G176 T177 G178 K179 S180 Y181 N277 M307 G336	G58 T59 G60 K61 S62 Y63 N159 M189 G218

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0001778	plasma membrane repair
GO:0006914	autophagy
GO:0006997	nucleus organization
GO:0007033	vacuole organization
GO:0015031	protein transport
GO:0016125	sterol metabolic process
GO:0016197	endosomal transport
GO:0016236	macroautophagy
GO:0031468	nuclear membrane reassembly
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway
GO:0036258	multivesicular body assembly
GO:0045053	protein retention in Golgi apparatus
GO:0045324	late endosome to vacuole transport
GO:0061709	reticulophagy
GO:0061764	late endosome to lysosome transport via multivesicular body sorting pathway
GO:0061952	midbody abscission
GO:0070676	intralumenal vesicle formation
GO:0071985	multivesicular body sorting pathway
GO:0090148	membrane fission
GO:0097352	autophagosome maturation

	Cellular Component
GO:0005643	nuclear pore
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005886	plasma membrane
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0030496	midbody
GO:1904949	ATPase complex
GO:1990621	ESCRT IV complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xmk, PDBe:5xmk, PDBj:5xmk
PDBsum	5xmk
PubMed	28714467
UniProt	P52917\|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]