Structure of PDB 5x1b Chain F |
>5x1bF (length=98) Species: 9913 (Bos taurus) [Search protein sequence] |
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVP SITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH |
|
PDB | 5x1b A nanosecond time-resolved XFEL analysis of structural changes associated with CO release from cytochrome c oxidase. |
Chain | F |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
F |
C60 C62 C82 C85 |
C60 C62 C82 C85 |
|
|
|
|