Structure of PDB 5whv Chain F |
>5whvF (length=119) Species: 85569 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT104) [Search protein sequence] |
NMADYNTYQSNVQINNLSYGVYRSGDKESQFFCVGLKRGSQVPNVHTICK IDVFGTHKQGFDNMLATARYYYATGEDVRIYYKENVWTDRNFTAAFSGNE LIAITTCTSSDYCMGPTLP |
|
PDB | 5whv Evolution of host adaptation in the Salmonella typhoid toxin. |
Chain | F |
Resolution | 2.303 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
F |
R59 P64 |
R38 P43 |
|
|
|