Structure of PDB 5vi5 Chain F

Receptor sequence

>5vi5F (length=314) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYAT
QKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRY
TGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMA
DQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKV
LEIQQYAREPISLDQTIDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVL
ETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKL
RHPSRSQVLRDYLD

3D structure

• PDB: 5vi5 Structural insights into the mycobacteria transcription initiation complex from analysis of X-ray crystal structures.
• Chain: F
• Resolution: 3.196 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	D164 V166 L170 L178 N237 R239 L240 S243 K246 F255 R268 K272 F273 D274 K277 Y279 K280 S282 T283 Y284 T286 W287 W288 Q291 R295 R305 V308 H309 R408 V436 T437 R440 Q443	D16 V18 L22 L30 N89 R91 L92 S95 K98 F107 R120 K124 F125 D126 K129 Y131 K132 S134 T135 Y136 T138 W139 W140 Q143 R147 R157 V160 H161 R256 V284 T285 R288 Q291
BS02	dna	F	I365 T426 L427 R438 R442	I217 T274 L275 R286 R290

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5vi5, PDBe:5vi5, PDBj:5vi5
• PDBsum: 5vi5
• PubMed: 28703128
• UniProt: A0QW02