Structure of PDB 5uq8 Chain F

Receptor sequence

>5uq8F (length=202) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

PDB

5uq8 Alternative Mode of E-Site tRNA Binding in the Presence of a Downstream mRNA Stem Loop at the Entrance Channel.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	N29 H31 W34 R38 W39 Q40 L41 K43 R44 R45 R46 T48 A49 S50 K52 T53 R54 G55 V57 A58 Y59 S60 R62 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 I78 P81 I82 F83 V84 V89 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K108 K135 T136 K137 R165 R168 N169 P171 E179 G180 N182 Y184	N24 H26 W29 R33 W34 Q35 L36 K38 R39 R40 R41 T43 A44 S45 K47 T48 R49 G50 V52 A53 Y54 S55 R57 K58 Q62 K63 H64 G66 R67 A68 R69 H70 G71 I73 P76 I77 F78 V79 V84 F85 P87 R90 Y94 T95 P97 K98 K99 V100 R101 K103 K130 T131 K132 R160 R163 N164 P166 E174 G175 N177 Y179

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5uq8, PDBe:5uq8, PDBj:5uq8
PDBsum	5uq8
PubMed	29456023
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]