Structure of PDB 5umd Chain F

Receptor sequence

>5umdF (length=390) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

PVANVYSTNGKNVVGEVEIPVVFQTPIRNDLIQSVYTNMSKNRRHPYAVK
LGAGYETSAESWGTGRAVARIPRVPGGGTHRAGQGAFGNMCRGGGMFNPT
KIWRRWGRKVNLKEKRYAVCSSIAASGVTSLVLARGHRISHLKEVPLVVS
NDIESLSKTKEAVNFLVSLGLKDEVNRLVKSKKIRAGKGKMRNRKYKIRN
GPLIIYENDNGVKKAFRNIPGVDLCKVTKLNLLKLAPGGSIGRLCIWSES
AFKKLDVIYGKIHEKKVTKKNYILPKSIVHNPDIYRIIHSDKVQASLLAK
KKPCKKRLQNKNSLTNFAVRCRLNPAYKLLRSLAVLRMRKSILEKSKNKK
EKRVQKQIQKKELQKINHDYYKGVAKAVKKKKKREEKKAK

3D structure

PDB

5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R33 Q38 Y41 T42 M44 S45 K46 N47 R48 R49 H50 Y52 V54 K55 L56 A58 Y60 E61 T62 S63 S66 T69 A72 V73 A74 R75 I76 P77 R78 P80 G82 G83 T84 R86 Q89 N94 M95 C96 R97 G98 M101 F102 N103 P104 T105 W108 R109 R110 R113 K114 N116 L117 K118 E119 K120 R121 Y122 R140 T164 K165 R182 K188 I189 R190 A191 G192 K193 K195 R197 N198 R199 K200 Y201 K202 R204 N205 K218 K219 R222 N223 P225 K231 K234 N236 K239 P242 G243 K270 K274 K275 Y290 K305 K306 K307 C309 K310 K311 R312 L313 Q314 N315 K316 N317 N321 F322 A323 C326 R327 Y332 K333 R336 S337 L341 M343 R344 K350 K354 K355 K357 R358 L368 N372 H373 D374 Y376 K377 K381 K385	R28 Q33 Y36 T37 M39 S40 K41 N42 R43 R44 H45 Y47 V49 K50 L51 A53 Y55 E56 T57 S58 S61 T64 A67 V68 A69 R70 I71 P72 R73 P75 G77 G78 T79 R81 Q84 N89 M90 C91 R92 G93 M96 F97 N98 P99 T100 W103 R104 R105 R108 K109 N111 L112 K113 E114 K115 R116 Y117 R135 T159 K160 R177 K183 I184 R185 A186 G187 K188 K190 R192 N193 R194 K195 Y196 K197 R199 N200 K213 K214 R217 N218 P220 K226 K229 N231 K234 P237 G238 K265 K269 K270 Y285 K300 K301 K302 C304 K305 K306 R307 L308 Q309 N310 K311 N312 N316 F317 A318 C321 R322 Y327 K328 R331 S332 L336 M338 R339 K345 K349 K350 K352 R353 L363 N367 H368 D369 Y371 K372 K376 K380
BS02	rna	F	P51 A53 K55 I107 M196	P46 A48 K50 I102 M191

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum	5umd
PubMed	28288098
UniProt	Q8I431

[Back to BioLiP]