Structure of PDB 5u7n Chain F |
>5u7nF (length=109) Species: 274 (Thermus thermophilus) [Search protein sequence] |
PTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIV FKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICTPHPF MFGTIVVKE |
|
PDB | 5u7n Engineering a bifunctional copper site in the cupredoxin fold by loop-directed mutagenesis. |
Chain | F |
Resolution | 2.3 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
F86 F88 |
Catalytic site (residue number reindexed from 1) |
F32 F34 |
Enzyme Commision number |
7.1.1.9: cytochrome-c oxidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
F |
H114 C149 H152 M155 |
H60 C95 H98 M101 |
|
|
|
|