Structure of PDB 5tbw Chain F

Receptor sequence

>5tbwF (length=260) Species: 559292 (Saccharomyces cerevisiae S288C)

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQGL

3D structure

• PDB: 5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.
• Chain: F
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R3 G4 P5 K6 K7 H8 K10 R11 L12 H16 L19 D21 K22 Y27 A28 P29 R30 A33 G34 K37 L38 R49 G58 R59 M66 K75 R77 K106 R108 L131 G132 K133 K134 V140 T146 R148 K155 G186 R187 H201 D202 V219 R221 N224 I248 R255	R2 G3 P4 K5 K6 H7 K9 R10 L11 H15 L18 D20 K21 Y26 A27 P28 R29 A32 G33 K36 L37 R48 G57 R58 M65 K74 R76 K105 R107 L130 G131 K132 K133 V139 T145 R147 K154 G185 R186 H200 D201 V218 R220 N223 I247 R254

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
• PDBsum: 5tbw
• PubMed: 29064494
• UniProt: P0CX35|RS4A_YEAST Small ribosomal subunit protein eS4A (Gene Name=RPS4A)