Structure of PDB 5t62 Chain F

Receptor sequence

>5t62F (length=361) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKP
AAVFTETLKHD

3D structure

PDB

5t62 Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	H36 T40 K44 K46 R47 Q48 Y50 V52 S53 Q59 T60 S61 T67 G68 A70 V71 R73 I74 P75 G80 G81 T82 R84 Q87 N92 M93 C94 R95 G96 R98 M99 F100 A101 P102 K104 W106 R107 K108 V111 K112 N114 H115 N116 E117 R119 R138 R141 T162 K183 K186 L187 R188 A189 K191 K193 Y194 R195 N196 R197 R202 R203 Y209 V216 K217 R220 N221 T227 L233 N234 P240 G241 H243 K271 V272 T287 I290 N291 G303 T306 Q307 K308 R309 V312 L313 K315 K319 N320 R326 N328 A331 K332 F334 A335 S341 K342 A344 T347 T349 P351	H35 T39 K43 K45 R46 Q47 Y49 V51 S52 Q58 T59 S60 T66 G67 A69 V70 R72 I73 P74 G79 G80 T81 R83 Q86 N91 M92 C93 R94 G95 R97 M98 F99 A100 P101 K103 W105 R106 K107 V110 K111 N113 H114 N115 E116 R118 R137 R140 T161 K182 K185 L186 R187 A188 K190 K192 Y193 R194 N195 R196 R201 R202 Y208 V215 K216 R219 N220 T226 L232 N233 P239 G240 H242 K270 V271 T286 I289 N290 G302 T305 Q306 K307 R308 V311 L312 K314 K318 N319 R325 N327 A330 K331 F333 A334 S340 K341 A343 T346 T348 P350
BS02	rna	F	A49 A51 K193 Y194	A48 A50 K192 Y193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t62, PDBe:5t62, PDBj:5t62
PDBsum	5t62
PubMed	28179369
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]