Structure of PDB 5t5m Chain F

Receptor sequence

>5t5mF (length=342) Species: 145261 (Methanothermobacter wolfeii)

ETTEVIEGKNITVERTGEENRRLIFQDCLCAVCGLCGEICPVSAIEVNPT
GAMVRTEQEKSKIAIDENKCVLCGMCSSICPFQALDLQIDGTSIKELAEY
PKIIKSAEIDDETCIQCKACETACPQDAITITRELPERKDLVTGEIEIDK
DTCIYCGMCEEMCPVDAIEIDHQTPSSASPVVATDIRVDEDKCVHCGICK
RICPVDAIMQVCRYEIKTPEVTGTSYIDPELCVNCGWCQEICPVDAATVT
KPFEGELIIDQDTCQACETCVMVCPCNVLSFPKPEKPGEKTTKLHKDERF
CIYCGACERSCPVTAITVKRNRINTTPIRSKAWKNAFDSLLK

3D structure

• PDB: 5t5m The methanogenic CO2 reducing-and-fixing enzyme is bifunctional and contains 46 [4Fe-4S] clusters.
• Chain: F
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	F	C154 I155 Y156 C157 G158 C160 I187 C204 P205 I209	C153 I154 Y155 C156 G157 C159 I186 C203 P204 I208
BS02	SF4	F	I147 C164 P165 I169 C194 V195 H196 C197 G198 C200	I146 C163 P164 I168 C193 V194 H195 C196 G197 C199
BS03	SF4	F	C281 P282 V285 C308 I309 Y310 C311 G312 C314	C274 P275 V278 C301 I302 Y303 C304 G305 C307
BS04	SF4	F	C271 Q272 C274 E275 C277 L301 C318 V320 A322 I323	C264 Q265 C267 E268 C270 L294 C311 V313 A315 I316
BS05	SF4	F	L24 C41 I46 C71 L73 C74 G75 C77	L23 C40 I45 C70 L72 C73 G74 C76
BS06	SF4	F	C31 C34 G35 C37 C81	C30 C33 G34 C36 C80
BS07	SF4	F	C125 I130 C239 V240 N241 C242 G243 C245	C124 I129 C232 V233 N234 C235 G236 C238
BS08	SF4	F	C115 I116 C118 K119 C121 C249 P250	C114 I115 C117 K118 C120 C242 P243

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:5t5m, PDBe:5t5m, PDBj:5t5m
• PDBsum: 5t5m
• PubMed: 27846502
• UniProt: O74028