Structure of PDB 5oy0 Chain F

Receptor sequence

>5oy0F (length=143) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]

ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGY
PHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQE
VVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

3D structure

PDB

5oy0 Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.

Chain

Resolution

2.501 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	F	G83 R84 Y86	G83 R84 Y86
BS02	CLA	F	Y86 L87 I103 M112	Y86 L87 I103 M112
BS03	CLA	F	A122 Y126	A122 Y126
BS04	CLA	F	F65 S69 F72 A76	F65 S69 F72 A76
BS05	CLA	F	F65 S69	F65 S69
BS06	CLA	F	W78 I79 V82 M112	W78 I79 V82 M112
BS07	CLA	F	D56 G57 R58 F59 I70 L73 Y74 W118	D56 G57 R58 F59 I70 L73 Y74 W118
BS08	ZEX	F	V55 G57 G77 G80 W81	V55 G57 G77 G80 W81

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center

External links

PDB	RCSB:5oy0, PDBe:5oy0, PDBj:5oy0
PDBsum	5oy0
PubMed	29414678
UniProt	P29256\|PSAF_SYNY3 Photosystem I reaction center subunit III (Gene Name=psaF)