Structure of PDB 5okc Chain F

Receptor sequence

>5okcF (length=132) Species: 559292 (Saccharomyces cerevisiae S288C)

PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPIM

3D structure

• PDB: 5okc Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
• Chain: F
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	F	P2 S3 V4 Q36 G37 E38 E40 F70 V84 G85 Q88 F106 N107 S108 N111 K126 D127 R128 P129	P1 S2 V3 Q35 G36 E37 E39 F69 V83 G84 Q87 F105 N106 S107 N110 K125 D126 R127 P128

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003677 DNA binding
• GO:0005515 protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0007064 mitotic sister chromatid cohesion
• GO:0034398 telomere tethering at nuclear periphery
• GO:0035753 maintenance of DNA trinucleotide repeats

Cellular Component

• GO:0005634 nucleus
• GO:0031390 Ctf18 RFC-like complex

External links

• PDB: RCSB:5okc, PDBe:5okc, PDBj:5okc
• PDBsum: 5okc
• PubMed: 29225079
• UniProt: P38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)