Structure of PDB 5mmm Chain F

Receptor sequence
>5mmmF (length=193) Species: 3562 (Spinacia oleracea) [Search protein sequence]
AAGTAVFVDKAEAETINRLKTNYIEKMVPLLKEEFSYSNILEVPKVVKIV
VNCGIGDASQNAKGLDAAINELALITGQRPVKTKAKTSIAGFKVREGMTL
GIAVTLRGNLMYSFLDRLINLALPRTRDFQGVNPNSFDGHGNYSVGFREQ
SVFPEIKPEIVGKARGMDVCITTTAKTDKEAYKLLSLMGMPFR
3D structure
PDB5mmm The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
ChainF
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F V88 N90 G92 T121 K124 I127 F130 L138 S174 H178 S182 G184 R186 G204 D206 V50 N52 G54 T83 K86 I89 F92 L100 S136 H140 S144 G146 R148 G166 D168
BS02 rna F N77 L79 E80 Q116 R117 V119 K120 K122 V142 T143 R145 N39 L41 E42 Q78 R79 V81 K82 K84 V104 T105 R107
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mmm, PDBe:5mmm, PDBj:5mmm
PDBsum5mmm
PubMed28007896
UniProtP82192|RK5_SPIOL Large ribosomal subunit protein uL5c (Gene Name=RPL5)

[Back to BioLiP]