Structure of PDB 5lsj Chain F |
>5lsjF (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] |
SLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTLGSSQNE VLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKV S |
|
PDB | 5lsj Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores. |
Chain | F |
Resolution | 3.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
F |
S203 L204 |
S1 L2 |
|
|
|
|