Structure of PDB 5li0 Chain F

Receptor sequence

>5li0F (length=199) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

NYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVK
NRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMP
KKMRRLALRSALSFKAQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKV
LVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKK

3D structure

PDB

5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	A36 Q40 R41 R45 Q46 T48 K52 R54 S55 G59 K63 K68 G71 R72 R74 G76 R79 Q82 R84 G85 I88 F90 P92 R95 K100 P102 K103 K104 M105 R106 E132 A133 P134 K137 V161 E164 T177 A178	A34 Q38 R39 R43 Q44 T46 K50 R52 S53 G57 K61 K66 G69 R70 R72 G74 R77 Q80 R82 G83 I86 F88 P90 R93 K98 P100 K101 K102 M103 R104 E130 A131 P132 K135 V159 E162 T175 A176

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum	5li0
PubMed	27906650
UniProt	Q2FW07\|RL4_STAA8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]