Structure of PDB 5kc1 Chain F

Receptor sequence
>5kc1F (length=61) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRL
RERWDSLVESA
3D structure
PDB5kc1 Characterization of Atg38 and NRBF2, a fifth subunit of the autophagic Vps34/PIK3C3 complex.
ChainF
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F E173 K180 E17 K24
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006914 autophagy
GO:0016236 macroautophagy
GO:0046854 phosphatidylinositol phosphate biosynthetic process
Cellular Component
GO:0000407 phagophore assembly site
GO:0005737 cytoplasm
GO:0005774 vacuolar membrane
GO:0016020 membrane
GO:0034045 phagophore assembly site membrane
GO:0034271 phosphatidylinositol 3-kinase complex, class III, type I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5kc1, PDBe:5kc1, PDBj:5kc1
PDBsum5kc1
PubMed27630019
UniProtQ05789|ATG38_YEAST Autophagy-related protein 38 (Gene Name=ATG38)

[Back to BioLiP]