Structure of PDB 5jvg Chain F

Receptor sequence
>5jvgF (length=63) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAA
ANTVAGTARSMGV
3D structure
PDB5jvg Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
ChainF
Resolution3.428 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F M74 K86 S88 S89 T90 P91 N92 L115 N116 A117 T126 T130 S133 M1 K13 S15 S16 T17 P18 N19 L42 N43 A44 T53 T57 S60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jvg, PDBe:5jvg, PDBj:5jvg
PDBsum5jvg
PubMed27791159
UniProtQ9RSS7|RL11_DEIRA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]