Structure of PDB 5gyr Chain F

Receptor sequence

>5gyrF (length=131) Species: 572477 (Allochromatium vinosum DSM 180)

AGLSPEEQIETRQAGYEFMGWNMGKIKANLEGEYNAAQVEAAANVIAAIA
NSGMGALYGPGTDKNVGDVKTRVKPEFFQNMEDVGKIAREFVGAANTLAE
VAATGEAEAVKTAFGDVGAACKSCHEKYRAK

3D structure

• PDB: 5gyr Formation and carbon monoxide-dependent dissociation of Allochromatium vinosum cytochrome c' oligomers using domain-swapped dimers
• Chain: F
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	F	R12 Q13 Y16 Y58 T71 R72 F91 C121 C124 H125 R129	R12 Q13 Y16 Y58 T71 R72 F91 C121 C124 H125 R129

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:5gyr, PDBe:5gyr, PDBj:5gyr
• PDBsum: 5gyr
• PubMed: 27883268
• UniProt: P00154|CYCP_ALLVD Cytochrome c' (Gene Name=cycA)