Structure of PDB 5gmk Chain F

Receptor sequence
>5gmkF (length=115) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRNY
3D structure
PDB5gmk Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
ChainF
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F K32 T33 R42 P59 S61 R62 K63 N65 K31 T32 R41 P58 S60 R61 K62 N64
BS02 rna F K5 K9 K4 K8
BS03 rna F K26 I41 K68 K25 I40 K67
BS04 rna F E3 R4 E2 R3
BS05 ZN F C51 C88 C50 C87
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
GO:0030620 U2 snRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gmk, PDBe:5gmk, PDBj:5gmk
PDBsum5gmk
PubMed27445308
UniProtP28320|YJU2_YEAST Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]