Structure of PDB 5gio Chain F

Receptor sequence

>5gioF (length=227) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]

ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREW
NAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKA
YGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDI
AQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLE
NSNFETIQIINLDPYDKDHAIVLSKYK

3D structure

PDB

5gio Box C/D guide RNAs recognize a maximum of 10 nt of substrates

Chain

Resolution

3.604 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	F	S110 R112 A155 P157 R184 S185 V188	S106 R108 A151 P153 R180 S181 V184
BS02	rna	F	R58 K60 S87 T89 K182 R184 D220 K221 H223	R54 K56 S83 T85 K178 R180 D216 K217 H219
BS03	SAH	F	Y82 G84 A86 T90 E108 F109 A134 D153 I154 A155 Q156	Y78 G80 A82 T86 E104 F105 A130 D149 I150 A151 Q152

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0008168	methyltransferase activity
GO:0008649	rRNA methyltransferase activity
GO:0016740	transferase activity
GO:1990259	histone H2AQ104 methyltransferase activity

	Biological Process
GO:0000494	box C/D sno(s)RNA 3'-end processing
GO:0006338	chromatin remodeling
GO:0006364	rRNA processing
GO:0008033	tRNA processing
GO:0031167	rRNA methylation
GO:0032259	methylation

	Cellular Component
GO:0031428	box C/D methylation guide snoRNP complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5gio, PDBe:5gio, PDBj:5gio
PDBsum	5gio
PubMed	27625427
UniProt	P58032\|FLPA_SACS2 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Gene Name=flpA)

[Back to BioLiP]