Structure of PDB 5fqd Chain F

Receptor sequence

>5fqdF (length=294) Species: 9606 (Homo sapiens) [Search protein sequence]

EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLY
ESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFT
MKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFG
LAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGY
VLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMY
LNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQ

3D structure

PDB

5fqd Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.

Chain

Resolution

2.45 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D136 K138
Catalytic site (residue number reindexed from 1)	D127 K129
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LVY	F	N39 G40	N30 G31

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0044024	histone H2AS1 kinase activity
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006338	chromatin remodeling
GO:0006468	protein phosphorylation
GO:0007030	Golgi organization
GO:0007165	signal transduction
GO:0007166	cell surface receptor signaling pathway
GO:0016055	Wnt signaling pathway
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0019082	viral protein processing
GO:0031670	cellular response to nutrient
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035025	positive regulation of Rho protein signal transduction
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045104	intermediate filament cytoskeleton organization
GO:0051301	cell division
GO:0090090	negative regulation of canonical Wnt signaling pathway
GO:1900226	negative regulation of NLRP3 inflammasome complex assembly
GO:1904263	positive regulation of TORC1 signaling

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005813	centrosome
GO:0005819	spindle
GO:0005829	cytosol
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
GO:0005856	cytoskeleton
GO:0005929	cilium
GO:0016020	membrane
GO:0016607	nuclear speck
GO:0030877	beta-catenin destruction complex
GO:0036064	ciliary basal body
GO:0042995	cell projection
GO:0045095	keratin filament

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5fqd, PDBe:5fqd, PDBj:5fqd
PDBsum	5fqd
PubMed	26909574
UniProt	P48729\|KC1A_HUMAN Casein kinase I isoform alpha (Gene Name=CSNK1A1)

[Back to BioLiP]