Structure of PDB 5exd Chain F

Receptor sequence

>5exdF (length=310) Species: 264732 (Moorella thermoacetica ATCC 39073)

MLDRIASIKKAPDEEYYVPGHRTCAGCGPALTYRLVAKAAGPNTIFIGPT
GCMYVANTSYGCGPWRVPWIHAQITNGGAVASGIEAAYKAMIRKKKTDAE
FPNIIVMAGDGGAVDIGLQALSAMLYRGHDVLFICYDNESYANTGIQTSP
TTPYGANTTFTPPGEVVPEGKKLFPKDNPKVIAHGHPELKYVATASIGWP
VDLMNKVRKGLNQEGPAYIHIHAPCPKGWQFPADKTIEMAKLAVQTGMFQ
LYEYENGEYKLSVKVDKRKPVSEYMKLQKRFAHLKPEHIAKMQAFVDARC
AEVGITVPVV

3D structure

• PDB: 5exd One-carbon chemistry of oxalate oxidoreductase captured by X-ray crystallography.
• Chain: F
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N143
• Catalytic site (residue number reindexed from 1): N143
• Enzyme Commision number: 1.2.7.10: oxalate oxidoreductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	F	C24 C27 P29 C52 A142 C225 K227	C24 C27 P29 C52 A142 C225 K227
BS02	O2T	F	T50 G51 C52 I74 D110 G111 Y136 N138 S140 Y141 A142 N143 T144	T50 G51 C52 I74 D110 G111 Y136 N138 S140 Y141 A142 N143 T144
BS03	MG	F	D110 N138 S140	D110 N138 S140

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0016625 oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor
• GO:0030976 thiamine pyrophosphate binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0033611 oxalate catabolic process

External links

• PDB: RCSB:5exd, PDBe:5exd, PDBj:5exd
• PDBsum: 5exd
• PubMed: 26712008
• UniProt: Q2RI42|OORB_MOOTA Oxalate oxidoreductase subunit beta (Gene Name=Moth_1591)