Structure of PDB 5exc Chain F |
>5excF (length=59) Species: 191210 (Dendronephthya sp. SSAL-2002) [Search protein sequence] |
LIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTLNLTVKEGAPLPF SYDILTTAL |
|
PDB | 5exc Crystal structure of the fluorescent protein from Dendronephthya sp. in both green and photoconverted red forms. |
Chain | F |
Resolution | 2.14 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
F |
I56 T58 T59 |
I54 T56 T57 |
|
|
|
|