Structure of PDB 5eh2 Chain F

Receptor sequence

>5eh2F (length=109) Species: 9606 (Homo sapiens)

PYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQR
THTGEKPYVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSH
LLRHQRTHT

3D structure

• PDB: 5eh2 Structural basis for human PRDM9 action at recombination hot spots.
• Chain: F
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.354: [histone H3]-lysine(4) N-trimethyltransferase.
  2.1.1.355: [histone H3]-lysine(9) N-trimethyltransferase.
  2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.
  2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
  2.1.1.362: [histone H4]-N-methyl-L-lysine(20) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	R726 F728 R736 H737 F756 H761 R764 H765 T768 R782 R785 N789 H793 T796 R810 N814 H817 R820 H821	R9 F11 R19 H20 F39 H44 R47 H48 T51 R65 R68 N72 H76 T79 R93 N97 H100 R103 H104	PDBbind-CN: Kd=28nM
BS02	dna	F	S760 H761 Y775 D786 K787 S788 K815 S816 L819 R823	S43 H44 Y58 D69 K70 S71 K98 S99 L102 R106	PDBbind-CN: Kd=28nM
BS03	ZN	F	C721 C724 H737 H741	C4 C7 H20 H24
BS04	ZN	F	C749 C752 H765 H769	C32 C35 H48 H52
BS05	ZN	F	C777 C780 H793 H797	C60 C63 H76 H80
BS06	ZN	F	C805 C808 H821 H825	C88 C91 H104 H108

External links

• PDB: RCSB:5eh2, PDBe:5eh2, PDBj:5eh2
• PDBsum: 5eh2
• PubMed: 26833727
• UniProt: Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 (Gene Name=PRDM9)