Structure of PDB 5e7o Chain F

Receptor sequence

>5e7oF (length=329) Species: 640081 (Azospira oryzae PS)

MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPG
LGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRV
RPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAI
YKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRI
EQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEP
NVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSER
EKKMKGLASDLMDVLIGRRSTDMMISPLT

3D structure

• PDB: 5e7o Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
• Chain: F
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F3S	F	C149 P150 I154 C170 K171 G172 A173 Q174 A175 C176 A194	C145 P146 I150 C166 K167 G168 A169 Q170 A171 C172 A190
BS02	SF4	F	C137 N138 C140 P143 C145 C180 P185	C133 N134 C136 P139 C141 C176 P181
BS03	SF4	F	C21 I22 G23 C24 Q25 C27 V49 P134 C216 V217 G218	C17 I18 G19 C20 Q21 C23 V45 P130 C212 V213 G214
BS04	SF4	F	C31 W35 R47 M136 C197 G199 C200 P210 C212	C27 W31 R43 M132 C193 G195 C196 P206 C208

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:5e7o, PDBe:5e7o, PDBj:5e7o
• PDBsum: 5e7o
• PubMed: 26940877
• UniProt: G8QM54