Structure of PDB 5dnm Chain F

Receptor sequence
>5dnmF (length=87) Species: 8355 (Xenopus laevis) [Search protein sequence]
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV
IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB5dnm Allosteric cross-talk in chromatin can mediate drug-drug synergy
ChainF
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R35 R45 I46 S47 G48 R78 K79 T80 R20 R30 I31 S32 G33 R63 K64 T65
BS02 dna F R36 R45 R21 R30
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dnm, PDBe:5dnm, PDBj:5dnm
PDBsum5dnm
PubMed28358030
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]