Structure of PDB 5chc Chain F

Receptor sequence

>5chcF (length=328) Species: 640081 (Azospira oryzae PS)

KAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGL
GYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVR
PSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIY
KREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIE
QGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPN
VFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSERE
KKMKGLASDLMDVLIGRRSTDMMISPLT

3D structure

• PDB: 5chc Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
• Chain: F
• Resolution: 2.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F3S	F	C149 P150 I154 C170 K171 G172 A173 Q174 A175 C176 A194	C144 P145 I149 C165 K166 G167 A168 Q169 A170 C171 A189
BS02	SF4	F	C137 N138 C140 P143 C145 C180 P185	C132 N133 C135 P138 C140 C175 P180
BS03	SF4	F	C21 I22 C24 Q25 C27 V49 P134 C216 V217 G218	C16 I17 C19 Q20 C22 V44 P129 C211 V212 G213
BS04	SF4	F	C31 W35 C197 G199 C200 C212	C26 W30 C192 G194 C195 C207

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:5chc, PDBe:5chc, PDBj:5chc
• PDBsum: 5chc
• PubMed: 26940877
• UniProt: G8QM54