Structure of PDB 5ch7 Chain F

Receptor sequence

>5ch7F (length=328) Species: 640081 (Azospira oryzae PS)

KAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGL
GYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVR
PSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIY
KREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIE
QGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPN
VFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSERE
KKMKGLASDLMDVLIGRRSTDMMISPLT

3D structure

• PDB: 5ch7 Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
• Chain: F
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F3S	F	C149 I154 C170 K171 G172 A173 Q174 A175 C176 A194	C144 I149 C165 K166 G167 A168 Q169 A170 C171 A189
BS02	SF4	F	C137 N138 H139 C140 P143 C145 C180	C132 N133 H134 C135 P138 C140 C175
BS03	SF4	F	C21 I22 C24 C27 R47 V49 P134 C216 V217 G218	C16 I17 C19 C22 R42 V44 P129 C211 V212 G213
BS04	SF4	F	C31 W35 R47 C197 G199 C200 P210 C212	C26 W30 R42 C192 G194 C195 P205 C207

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:5ch7, PDBe:5ch7, PDBj:5ch7
• PDBsum: 5ch7
• PubMed: 26940877
• UniProt: G8QM54