Structure of PDB 5cb6 Chain F

Receptor sequence
>5cb6F (length=173) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
RGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLG
FSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFL
EVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRT
DLEELDESVGKIWQKLVDLKYIE
3D structure
PDB5cb6 Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
ChainF
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.25: adenylyl-sulfate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADX F D42 R45 F54 R59 N62 A84 I85 K120 L122 G133 F134 D39 R42 F51 R56 N59 A81 I82 K117 L119 G130 F131
BS02 ANP F S14 G15 G17 K18 T19 T20 R117 K120 T153 E156 E157 L158 S161 S11 G12 G14 K15 T16 T17 R114 K117 T150 E153 E154 L155 S158
BS03 MG F T19 D40 D42 T16 D37 D39
Gene Ontology
Molecular Function
GO:0004020 adenylylsulfate kinase activity
GO:0004781 sulfate adenylyltransferase (ATP) activity
GO:0005524 ATP binding
GO:0016301 kinase activity
Biological Process
GO:0000103 sulfate assimilation
GO:0010134 sulfate assimilation via adenylyl sulfate reduction
GO:0016310 phosphorylation
GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
GO:0070814 hydrogen sulfide biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5cb6, PDBe:5cb6, PDBj:5cb6
PDBsum5cb6
PubMed26294763
UniProtP72940|CYSC_SYNY3 Probable adenylyl-sulfate kinase (Gene Name=cysC)

[Back to BioLiP]