Structure of PDB 5c2w Chain F

Receptor sequence

>5c2wF (length=314) Species: 174633 (Candidatus Kuenenia stuttgartiensis)

GQPRVISTIQTGATWEPLGREEPLTVPEVHFRVKHSPFKSELVRYGQFQF
NDAAWSLQGSYSCASCHYERGQTTGLIWDLGDEGWGSWKNTKYIRGGRYL
PPFRHEGFTGHPDEIVGATSSLDRVCGRDPGFVFRSENFSPMRLEALICY
IRALEFTGSPFRNADGSLTEAQKRGQKIFEDPKVGCLECHPGDPMDPRAL
FSDAQTHDVGTGRVGVNGFRSTPGKVFNISALEAGEDPYGVESNTPIIGL
DLVKEFDTPTLRDIYASGTYFHDGGARTLMDTINNTVNDKDMHGRTSHLK
QQELQDLVEYLKAL

3D structure

• PDB: 5c2w The inner workings of the hydrazine synthase multiprotein complex.
• Chain: F
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 1.7.2.7: hydrazine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	F	N129 S306 T308	N90 S267 T269
BS02	CA	F	L139 P141 D296	L100 P102 D257
BS03	CA	F	D118 L119 E122 G123 S126	D79 L80 E83 G84 S87
BS04	HEC	F	Y100 C102 C105 H106 W117 K128 F142 R143 H144 V164 C165 D168 F173	Y61 C63 C66 H67 W78 K89 F103 R104 H105 V125 C126 D129 F134
BS05	HEC	F	C225 C228 H229 V248 T250 F295 P298 I303 Y309 F310 H311 H332	C186 C189 H190 V209 T211 F256 P259 I264 Y270 F271 H272 H293

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0044222 anammoxosome

External links

• PDB: RCSB:5c2w, PDBe:5c2w, PDBj:5c2w
• PDBsum: 5c2w
• PubMed: 26479033
• UniProt: Q1Q0T3|HZSG_KUEST Hydrazine synthase subunit gamma (Gene Name=kuste2860)