Structure of PDB 5b0w Chain F

Receptor sequence

>5b0wF (length=260) Species: 348780 (Natronomonas pharaonis DSM 2160)

EVTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLDDPRAKLI
AVSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGV
VTMWGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAA
LTTSSHLMRWFWYAISCACFIVVLYILLVEWAQDAKAAGTADIFSTLKLL
TVVMWLGYPIVWALGVEGVAVLPVGYTSWAYSALDIVAKYIFAFLLLNYL
TSNEGVVSGS

3D structure

• PDB: 5b0w Crystal Structure of the 11-cis Isomer of Pharaonis Halorhodopsin: Structural Constraints on Interconversions among Different Isomeric States
• Chain: F
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	22B	F	I49 V53 T56	I32 V36 T39
BS02	RET	F	W127 T131 M159 Y180 S183 C184 F187 W222 Y225 P226 K256	W110 T114 M142 Y163 S166 C167 F170 W205 Y208 P209 K239
BS03	RET	F	W127 T131 M159 Y180 S183 C184 F187 W222 Y225 P226 W229 D252 K256	W110 T114 M142 Y163 S166 C167 F170 W205 Y208 P209 W212 D235 K239

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 19:33:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5b0w', asym_id = 'F', title = 'Crystal Structure of the 11-cis Isomer of Pharao...Interconversions among Different Isomeric States '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5b0w', asym_id='F', title='Crystal Structure of the 11-cis Isomer of Pharao...Interconversions among Different Isomeric States ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005216,0006811,0016020', uniprot = '', pdbid = '5b0w', asym_id = 'F'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005216,0006811,0016020', uniprot='', pdbid='5b0w', asym_id='F')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>