Structure of PDB 5a04 Chain F

Receptor sequence

>5a04F (length=335) Species: 190650 (Caulobacter vibrioides CB15)

RKLGYAILGLGYYATRIIMPRFAECEHSRLAALVSGTPEKLKTYGEQYGI
PETHRYSYETFDRIIDNPDVDIVYVITPNSLHRPFTERAARAGKHVMCEK
PMANTVADCEAMIAACKKAGRKLMIGYRSRFQAHNIEAIKLVRDGALGPV
RTVVTDHGFTIGDPKQWRLNRALAGGGSLMDIGIYSLNAARYLTGEEPVA
VNAVESTDRSDPRFGEVEDIINFQLLFPSGATANCVSAYSVNCNRYRVSG
PKGWVEIDPATSYQGQAMRAQLGGPPAPREPAPQPKNQFSAQLDHLSECI
LTGREPIVGGDDGLKDLRVIEAIYRAAREGRTVKL

3D structure

• PDB: 5a04 Structure and Function of Caulobacter Crescentus Aldose-Aldose Oxidoreductase.
• Chain: F
• Resolution: 1.698 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K104 Y189
• Catalytic site (residue number reindexed from 1): K100 Y185
• Enzyme Commision number: 1.1.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	F	L14 G15 Y16 Y17 S39 G40 T41 K44 Y62 I80 T81 P82 L85 H86 E103 K104 R132 W171 R172 Y189 Y267	L10 G11 Y12 Y13 S35 G36 T37 K40 Y58 I76 T77 P78 L81 H82 E99 K100 R128 W167 R168 Y185 Y263
BS02	BGC	F	E209 S210 T211 R213	E205 S206 T207 R209
BS03	BGC	F	K104 F163 R172 D185 Y189	K100 F159 R168 D181 Y185

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding

External links

• PDB: RCSB:5a04, PDBe:5a04, PDBj:5a04
• PDBsum: 5a04
• PubMed: 26438878
• UniProt: Q9A8X3