Structure of PDB 4zhx Chain F

Receptor sequence
>4zhxF (length=300) Species: 9606 (Homo sapiens) [Search protein sequence]
NSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLW
DSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDS
FKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKF
LKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRV
SALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEG
VLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT
3D structure
PDB4zhx Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
ChainF
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 AMP F R70 K170 I240 S242 F244 D245 R269 F273 L277 V297 R299 R45 K145 I215 S217 F219 D220 R244 F248 L252 V272 R274
BS02 AMP F H151 T200 I204 A205 V225 S226 I312 S314 S316 D317 H126 T175 I179 A180 V200 S201 I287 S289 S291 D292
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004691 cAMP-dependent protein kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008603 cAMP-dependent protein kinase regulator activity
GO:0016208 AMP binding
GO:0019887 protein kinase regulator activity
GO:0019901 protein kinase binding
GO:0043531 ADP binding
Biological Process
GO:0006110 regulation of glycolytic process
GO:0006468 protein phosphorylation
GO:0006633 fatty acid biosynthetic process
GO:0007165 signal transduction
GO:0007283 spermatogenesis
GO:0010628 positive regulation of gene expression
GO:0031669 cellular response to nutrient levels
GO:0045860 positive regulation of protein kinase activity
GO:0051170 import into nucleus
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0031588 nucleotide-activated protein kinase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4zhx, PDBe:4zhx, PDBj:4zhx
PDBsum4zhx
PubMed26952388
UniProtP54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=PRKAG1)

[Back to BioLiP]